General Information

  • ID:  hor005967
  • Uniprot ID:  P22923
  • Protein name:  Corticotropin
  • Gene name:  pomc
  • Organism:  Pelophylax ridibundus (Marsh frog) (Rana ridibunda)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSEIFPLEL
  • Length:  39(141-179)
  • Propeptide:  MLQPVWSCILALLGVFIFHVGEVRSQCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHMQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNGGYKREDIANYPILNLLTGSDNQNTQQGIMEDEAVDRQDSKRSYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSEIFPLELRRELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNA
  • Signal peptide:  MLQPVWSCILALLGVFIFHVGEVRS
  • Modification:  T13 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]:
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P22923-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005967_AF2.pdbhor005967_ESM.pdb

Physical Information

Mass: 530021 Formula: C211H323N55O60S
Absent amino acids: CNQ Common amino acids: E
pI: 7.54 Basic residues: 8
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: -84.62 Boman Index: -9244
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 57.44
Instability Index: 8363.33 Extinction Coefficient cystines: 6990
Absorbance 280nm: 183.95

Literature

  • PubMed ID:  2260977
  • Title:  Characterization of the cDNA encoding proopiomelanocortin in the frog Rana ridibunda.